bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_1308_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value Hs8923930 41.6 4e-04 At5g51720 40.4 9e-04 Hs22044166 39.7 0.001 CE03767_1 37.0 0.010 7301766 36.6 0.013 Hs17435381 30.8 0.62 7301946 28.9 2.2 CE02915 27.7 6.0 7302300 27.3 7.1 > Hs8923930 Length=108 Score = 41.6 bits (96), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query 10 CRCWQSTKFPICDNSH-KVLQKQGCNCGPAMLEIRQ 44 CRCW+S KFP CD +H K ++ G N GP +++ ++ Sbjct 72 CRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKE 107 > At5g51720 Length=108 Score = 40.4 bits (93), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query 10 CRCWQSTKFPICDNSH-KVLQKQGCNCGPAMLE 41 CRCW+S FP+CD SH K + G N GP +L+ Sbjct 74 CRCWRSGTFPLCDGSHVKHNKANGDNVGPLLLK 106 > Hs22044166 Length=547 Score = 39.7 bits (91), Expect = 0.001, Method: Compositional matrix adjust. Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query 10 CRCWQSTKFPICDNSH-KVLQKQGCNCGPAMLEIRQA 45 C CW+ KFP CD SH K ++ G N GP ++E ++ Sbjct 511 CHCWRYKKFPFCDGSHTKHNEQTGDNVGPLIIEKKET 547 > CE03767_1 Length=148 Score = 37.0 bits (84), Expect = 0.010, Method: Compositional matrix adjust. Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%) Query 10 CRCWQSTKFPICDNSHKVLQKQ-GCNCGPAMLE 41 CRCW+S K+P CD SH K+ G N GP +++ Sbjct 98 CRCWKSEKWPYCDGSHGKHNKETGDNVGPLIVK 130 > 7301766 Length=133 Score = 36.6 bits (83), Expect = 0.013, Method: Compositional matrix adjust. Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Query 10 CRCWQSTKFPICDNSHKVLQKQ-GCNCGPAMLE 41 CRCW++ +P CD SH KQ G N GP +++ Sbjct 100 CRCWKTKNWPYCDGSHGEHNKQTGDNVGPIVIK 132 > Hs17435381 Length=141 Score = 30.8 bits (68), Expect = 0.62, Method: Compositional matrix adjust. Identities = 12/19 (63%), Positives = 14/19 (73%), Gaps = 1/19 (5%) Query 10 CRCWQSTKFPICDN-SHKV 27 C CW+S KFP+CD SHK Sbjct 99 CHCWRSRKFPLCDGVSHKT 117 > 7301946 Length=704 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Query 24 SHKVLQKQGCNCGPAMLEIRQAPSVEEPRAFKSTAGTSKDNP 65 S KV + +GC PAM A + + P AF GT+ DNP Sbjct 370 SRKVDKIRGCQ--PAMGYSFAAGTTDGPGAFSFEQGTTTDNP 409 > CE02915 Length=331 Score = 27.7 bits (60), Expect = 6.0, Method: Compositional matrix adjust. Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 0/33 (0%) Query 22 DNSHKVLQKQGCNCGPAMLEIRQAPSVEEPRAF 54 DN + V++K GC +E+ Q S +EP + Sbjct 19 DNKNDVIEKVGCGLHSTNVELAQTRSAQEPADY 51 > 7302300 Length=134 Score = 27.3 bits (59), Expect = 7.1, Method: Compositional matrix adjust. Identities = 9/25 (36%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 2 KRTQNFSVCRCWQSTKFPICDNSHK 26 +++ ++ +C C Q+T P CD +HK Sbjct 101 EKSGDYWLCNCKQTTHRPFCDGTHK 125 Lambda K H 0.324 0.132 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174970866 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40