bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0995_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value Hs19923787 49.3 2e-06 At4g39220 47.0 8e-06 At2g23310 46.6 1e-05 At2g21600 46.2 1e-05 At2g18240_1 42.7 2e-04 CE03349 40.0 0.001 YCL001w 39.3 0.002 SPAC22E12.05c 36.6 0.012 7301302 34.3 0.060 Hs18580689_2 32.3 0.22 ECU08g0700 30.0 1.0 Hs17441050 29.6 1.3 Hs17443156 29.6 1.5 At1g29230 29.3 2.0 Hs22055990 29.3 2.1 Hs17457220 29.3 2.1 Hs22047440 28.5 3.5 7301861 28.1 3.8 CE16592 28.1 3.9 CE07387 27.7 5.0 Hs22067198 27.7 5.2 > Hs19923787 Length=206 Score = 49.3 bits (116), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 22/57 (38%), Positives = 35/57 (61%), Gaps = 0/57 (0%) Query 66 RVWASVGRVSNAYLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 R + +G++ ++L+KS Y RW+V Y+ RVY L G+++V+Y LGIY L Sbjct 20 RFFTRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYLLQGWYIVTYALGIYHL 76 > At4g39220 Length=191 Score = 47.0 bits (110), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 0/50 (0%) Query 73 RVSNAYLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 R+ YL+K+ + RW+ Y RVY++ GF++++YGLGIYLL Sbjct 24 RIYQHYLDKTTPHANYRWIGTLVVALIYCLRVYYIQGFYIIAYGLGIYLL 73 > At2g23310 Length=211 Score = 46.6 bits (109), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 7/60 (11%) Query 70 SVGRVSNAY-------LNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 +V R+ +A+ L+K++ ++ RW+ + YI RVYF+ GF++++Y +GIYLL Sbjct 36 AVNRLIHAFSQRQQHLLDKTVPHVLYRWIACLCVVLIYIVRVYFVEGFYIITYAIGIYLL 95 > At2g21600 Length=195 Score = 46.2 bits (108), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 22/50 (44%), Positives = 30/50 (60%), Gaps = 0/50 (0%) Query 73 RVSNAYLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 RV YL+K+ + RW+ Y RVY + GF+++SYGLGIYLL Sbjct 24 RVYQYYLDKTTPHSTNRWIGTLVFFLIYCLRVYSIHGFYIISYGLGIYLL 73 > At2g18240_1 Length=180 Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 0/45 (0%) Query 78 YLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 YL++S + RWLV YI RVY + G+FV+SYGL Y+L Sbjct 33 YLDRSAPNIVRRWLVTLVAAVIYIYRVYSVYGYFVISYGLATYIL 77 > CE03349 Length=191 Score = 40.0 bits (92), Expect = 0.001, Method: Compositional matrix adjust. Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Query 58 LADQP-FSSRVWASVGRVSNAYLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYG 116 L D+P +SR + S+ YL++ + RW++ L F+ +R+ L GF++V+Y Sbjct 5 LRDRPGVTSRFFHSLEVKYQYYLDRLTPHTAFRWVIALISLVFFASRIILLQGFYIVAYA 64 Query 117 LGI 119 +GI Sbjct 65 VGI 67 > YCL001w Length=188 Score = 39.3 bits (90), Expect = 0.002, Method: Compositional matrix adjust. Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 0/45 (0%) Query 78 YLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 YL+K + K RW VL L ++ R+ G++V+ YGLG++LL Sbjct 31 YLDKVTPHAKERWAVLGGLLCLFMVRITMAEGWYVICYGLGLFLL 75 > SPAC22E12.05c Length=184 Score = 36.6 bits (83), Expect = 0.012, Method: Compositional matrix adjust. Identities = 16/50 (32%), Positives = 30/50 (60%), Gaps = 0/50 (0%) Query 73 RVSNAYLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 R+ +++++I Y RWL + +A + R+ + G+++V Y L IYLL Sbjct 20 RLYRHWVDRTIPYTTYRWLTVSGLIALFFIRILLVRGWYIVCYTLAIYLL 69 > 7301302 Length=203 Score = 34.3 bits (77), Expect = 0.060, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 3/53 (5%) Query 73 RVSNAY---LNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 R+S Y L++S + + RW+ L ++ R++ G+++V Y LGIY L Sbjct 20 RLSQTYQSALDRSTPHTRMRWVFAGFLLLLFVLRIFIYQGWYIVCYALGIYHL 72 > Hs18580689_2 Length=306 Score = 32.3 bits (72), Expect = 0.22, Method: Compositional matrix adjust. Identities = 16/68 (23%), Positives = 34/68 (50%), Gaps = 2/68 (2%) Query 28 RGGRNSEKGHLLGHYTIALRTMMASMSAEELADQPFSSRVWASVGRVSNAYLNKSILYLK 87 + G+ E H L YT+ ++ ++ ++ + +QP+S + + + + N Y+ K L Sbjct 50 KNGQTHE--HALLAYTLGVKQLIVGVNKMDSTEQPYSQKTYEEIVKEVNTYIMKIGCNLD 107 Query 88 TRWLVLFA 95 T VL + Sbjct 108 TAAFVLIS 115 > ECU08g0700 Length=166 Score = 30.0 bits (66), Expect = 1.0, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 0/53 (0%) Query 70 SVGRVSNAYLNKSILYLKTRWLVLFACLAFYIARVYFLAGFFVVSYGLGIYLL 122 + + YL++ RW + FY R++ F++++Y LGIYLL Sbjct 2 DLKTLQQIYLDRLAPRPDVRWGITGVLFLFYCIRIWSTGAFYLITYCLGIYLL 54 > Hs17441050 Length=462 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 10/45 (22%), Positives = 26/45 (57%), Gaps = 0/45 (0%) Query 37 HLLGHYTIALRTMMASMSAEELADQPFSSRVWASVGRVSNAYLNK 81 H L YT+ ++ ++ +++ ++ + P+SS + + + AY+ K Sbjct 186 HTLLAYTLGMKQLIVTVNKMDITEPPYSSTCFEEISKEVKAYIKK 230 > Hs17443156 Length=1309 Score = 29.6 bits (65), Expect = 1.5, Method: Composition-based stats. Identities = 22/66 (33%), Positives = 28/66 (42%), Gaps = 6/66 (9%) Query 8 SEDRAGTLCGGLLPELPSTPRG------GRNSEKGHLLGHYTIALRTMMASMSAEELADQ 61 SE R L L+ LP++ +G G EKG LG + R S L+ Q Sbjct 570 SERRGVWLVAPLIARLPTSVQGRVLKAAGEELEKGQHLGSSSKKERDRQKQKSMSLLSQQ 629 Query 62 PFSSRV 67 PF S V Sbjct 630 PFLSLV 635 > At1g29230 Length=520 Score = 29.3 bits (64), Expect = 2.0, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 6/35 (17%) Query 17 GGLLPELPSTPRGGRNS------EKGHLLGHYTIA 45 G + P+ P +PR RN+ E G LLGH T A Sbjct 52 GNISPQSPRSPRSPRNNILMGKYELGKLLGHGTFA 86 > Hs22055990 Length=143 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query 2 GFIRFLSEDRAGTLCGGLLPELPSTPRGG 30 GF L D+ LCG LLP LPS P G Sbjct 20 GFPCLLQGDQDPPLCG-LLPHLPSDPHGA 47 > Hs17457220 Length=143 Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust. Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Query 2 GFIRFLSEDRAGTLCGGLLPELPSTPRGG 30 GF L D+ LCG LLP LPS P G Sbjct 20 GFPCLLQGDQDPPLCG-LLPHLPSDPHGA 47 > Hs22047440 Length=639 Score = 28.5 bits (62), Expect = 3.5, Method: Composition-based stats. Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Query 24 PSTPRGGRNSEKGHLLGHYTIALRTMMASMSAEELADQPFSSRVWAS 70 P++P GG +S HL I L + + A E+ DQP +W S Sbjct 178 PASPGGGLDS--CHLNRSPAIPLHPNIGELQALEVLDQPEPGLIWES 222 > 7301861 Length=1275 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 6/82 (7%) Query 31 RNSEKGHLLGHYTIALRTMMASMSAEEL----ADQPFS--SRVWASVGRVSNAYLNKSIL 84 R E+G L G +A+ T + ++ EEL +D F +W V +SN + IL Sbjct 412 RKHERGSLPGPIELAIITYIMALIFEELKSLYSDGLFEYIMDLWNIVDYISNMFYVTWIL 471 Query 85 YLKTRWLVLFACLAFYIARVYF 106 T W+++ L F YF Sbjct 472 CRATAWVIVHRDLWFRGIDPYF 493 > CE16592 Length=259 Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 0/33 (0%) Query 41 HYTIALRTMMASMSAEELADQPFSSRVWASVGR 73 HY A+ + S E A+QP+S +V++ VGR Sbjct 107 HYLSAVNSSKIKKSFEISAEQPYSEQVFSGVGR 139 > CE07387 Length=514 Score = 27.7 bits (60), Expect = 5.0, Method: Composition-based stats. Identities = 9/33 (27%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 82 SILYLKTRWLVLFACLAFYIARVYFLAGFFVVS 114 +++ +K RW +L+ L+F I+ +F +F+++ Sbjct 111 TVIEMKWRWCLLYFSLSFMISWSFFATVYFLIA 143 > Hs22067198 Length=402 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 11/17 (64%), Positives = 12/17 (70%), Gaps = 0/17 (0%) Query 27 PRGGRNSEKGHLLGHYT 43 P G +NS KG LLGH T Sbjct 224 PFGSKNSSKGQLLGHET 240 Lambda K H 0.327 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194805952 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40