bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Emax_0103_orf1 Length=73 Score E Sequences producing significant alignments: (Bits) Value Hs4503981 30.0 1.1 At2g19950 29.3 1.8 At3g24090 29.3 1.9 CE27144 28.9 2.6 SPBC12C2.11 28.5 2.8 At3g03090 28.1 4.1 Hs22057041 27.3 7.8 > Hs4503981 Length=681 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 5 HEQTSHSLWAFTGEPRPLNLCPQLS 29 H +H+ WA GEP P+N PQ S Sbjct 88 HLGIAHTRWATHGEPSPVNSHPQRS 112 > At2g19950 Length=713 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 24/66 (36%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Query 5 HEQTSHSLWAFTGEPRPLNLCPQLSMF----TVLFLLKAFLVLFRNGVKLAEGFLVFFCG 60 HE +H TG R L +LS F T++F L AF + +N VKL + V Sbjct 607 HEAQTHGYSEHTG--RDLGAHYELSAFSFNFTLMFALFAFCLQLQNAVKLLDSGAVR--A 662 Query 61 FDFLWR 66 FLWR Sbjct 663 TRFLWR 668 > At3g24090 Length=691 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Query 5 HEQTSHSLWAFTGEPRPLNLCPQLS 29 H +H+ WA GEP P N PQ S Sbjct 81 HAGIAHTRWATHGEPAPRNSHPQSS 105 > CE27144 Length=236 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 6/37 (16%) Query 37 LKAFLVLFRNGVKLAEGFLVFFCGFDFLWRGNAEEMC 73 LKA+L NG+ F++F C F F +EMC Sbjct 162 LKAYLGFLDNGLSAGGRFVIFSCNFTF------DEMC 192 > SPBC12C2.11 Length=696 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 0/25 (0%) Query 5 HEQTSHSLWAFTGEPRPLNLCPQLS 29 H SH+ WA G P P+N PQ S Sbjct 80 HCAISHTRWATHGIPSPINCHPQRS 104 > At3g03090 Length=342 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 0/41 (0%) Query 20 RPLNLCPQLSMFTVLFLLKAFLVLFRNGVKLAEGFLVFFCG 60 RPL LC M LFLL ++ + ++N +A L+ + G Sbjct 210 RPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVG 250 > Hs22057041 Length=377 Score = 27.3 bits (59), Expect = 7.8, Method: Compositional matrix adjust. Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 0/44 (0%) Query 1 AHSRHEQTSHSLWAFTGEPRPLNLCPQLSMFTVLFLLKAFLVLF 44 AH ++H+ A P PL L PQL M + L +A L F Sbjct 218 AHDLKVGSNHTSKAAVRSPFPLGLSPQLIMIVQIALHQALLTGF 261 Lambda K H 0.332 0.144 0.489 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187734408 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40