bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3402_orf1 Length=109 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd1_810 66.6 2e-10 > 5807.cgd1_810 Length=600 Score = 66.6 bits (161), Expect = 2e-10, Method: Composition-based stats. Identities = 26/64 (40%), Positives = 45/64 (70%), Gaps = 0/64 (0%) Query 36 DTHDHLVLELVNGGELRKLLKSKYSTGMPLEVARAYIYQIICSLVLIHSKCIVHRDLKTQ 95 D ++L++EL +GG +R+LL+ KY G+P+ R +Y ++ + +HSK +VHRDLKT Sbjct 255 DNREYLIMELFHGGTIRQLLRFKYKNGLPINSVRNLMYTLLVGISQMHSKGVVHRDLKTA 314 Query 96 NILV 99 N+++ Sbjct 315 NLML 318 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22374500883 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40