bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3400_orf2 Length=206 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0233 300 2e-80 > 5833.PF13_0233 Length=818 Score = 300 bits (767), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 139/206 (67%), Positives = 167/206 (81%), Gaps = 0/206 (0%) Query 1 DPEAVMRELTMKVTFAGGQRVESRWRQEDGDMLKSSLAKAMYDKLFLWIISELNKSIKPP 60 DPE + RE+ +KVT AGG ++E RW + D ++LKSSL KAMY+KLFLWII LN I+P Sbjct 399 DPELIKREILIKVTVAGGTKIEGRWNKNDAEVLKSSLCKAMYEKLFLWIIRHLNSRIEPE 458 Query 61 EGFKNFLGMLDIFGFEVFKNNSLEQFFINVTNEMLQKNFVDIVFTREAKLYKEEDVSTAE 120 GFK F+GMLDIFGFEVFKNNSLEQ FIN+TNEMLQKNFVDIVF RE+KLYK+E +STAE Sbjct 459 GGFKTFMGMLDIFGFEVFKNNSLEQLFINITNEMLQKNFVDIVFERESKLYKDEGISTAE 518 Query 121 LVYTSNTDVITLLTDKKNSILSSLEDQCLAPGGSDEKFVAACKSAFKNSSKFKPAKVSPN 180 L YTSN +VI +L +K S+LS LEDQCLAPGG+DEKFV++C + K ++KF PAKV+ N Sbjct 519 LKYTSNKEVINVLCEKGKSVLSYLEDQCLAPGGTDEKFVSSCATNLKENNKFTPAKVASN 578 Query 181 INFLVSHTIGDIQYSAEGFLFKNKDV 206 NF++ HTIG IQY AE FL KNKDV Sbjct 579 KNFIIQHTIGPIQYCAESFLLKNKDV 604 Lambda K H 0.317 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 51449491716 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40