bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3383_orf1 Length=111 Score E Sequences producing significant alignments: (Bits) Value 42254.ENSSARP00000010110 94.4 9e-19 > 42254.ENSSARP00000010110 Length=4520 Score = 94.4 bits (233), Expect = 9e-19, Method: Composition-based stats. Identities = 47/116 (40%), Positives = 63/116 (54%), Gaps = 13/116 (11%) Query 5 ILPGPCSSNPCQNGGTCE-LPSG--TCKCPACFTGANCETPVSGCCSSDADCNGHGSCE- 60 + P C+ PCQ+GG+C LPSG C C + FTG+NCE+ ++ C + C GSC+ Sbjct 4015 LYPDACARGPCQHGGSCSSLPSGGYQCACQSQFTGSNCESEITACFPN--PCRNGGSCDP 4072 Query 61 ---SNKCKCNAGFSGAMCE--TGACDNVTCMNGGTCQMPSGA--CSCADGYMGSRC 109 S C C AG +GA CE C C NGG C G+ C+C G++G RC Sbjct 4073 IGNSYTCSCRAGLTGATCEEDVDECAREECENGGACVNVFGSFMCNCTRGFVGPRC 4128 Lambda K H 0.317 0.132 0.477 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23016794144 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40