bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3332_orf1 Length=93 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1200 88.2 7e-17 > 5807.cgd4_1200 Length=322 Score = 88.2 bits (217), Expect = 7e-17, Method: Composition-based stats. Identities = 38/57 (66%), Positives = 45/57 (78%), Gaps = 0/57 (0%) Query 36 FSASYTAYPVSFAAKDHLESGNKILLPPSALHALARLHISWPMHFRICNPAKDKLTH 92 F Y+ YPVSFA +D LE GNKILLPPSAL+ LAR +I+WPM F+I NPAK+K TH Sbjct 44 FINEYSCYPVSFAGRDELEGGNKILLPPSALNQLARRNITWPMLFQISNPAKNKFTH 100 Lambda K H 0.325 0.141 0.481 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22770216990 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40