bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3314_orf1 Length=145 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL1P2.18 108 6e-23 > 5833.MAL1P2.18 Length=1029 Score = 108 bits (269), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 59/133 (44%), Positives = 84/133 (63%), Gaps = 2/133 (1%) Query 3 SSFLSFLIKCISSFNANHLNGPHGLWISNTGNGNGEFVSVSFVQPVQINRFVYMPPNDPL 62 SS LS CI+ ++ H++ +W S +G GE++ VSF PVQIN+F + P +D L Sbjct 593 SSSLSKEFNCIAGLSSLHMDKKFHVWRS-LNSGIGEYIKVSFNTPVQINKFRFKPRDDVL 651 Query 63 MWPSEITFTFEDGEKEIISILHTANINYNSYLLSMPRVTTRVKIEITQMYINGGDSGGFF 122 WPSEI+ F+D E II ILHT+NI +N+ L P +TT VKIEI M++N ++GG F Sbjct 652 TWPSEISLLFDDTEI-IIPILHTSNIEHNTTKLEHPIITTFVKIEIKDMFLNHNETGGSF 710 Query 123 ELWGVPCHKQEEE 135 EL G C+ ++ Sbjct 711 ELIGNSCNLTNDD 723 Lambda K H 0.316 0.135 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40