bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3310_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_30 162 3e-39 > 5807.cgd2_30 Length=503 Score = 162 bits (411), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 74/153 (48%), Positives = 107/153 (69%), Gaps = 1/153 (0%) Query 22 YEDRRRQFIRDFSADYSIQAEETAQRELKRLQGDTYLDYAGSSLYQEQQILSVFKDLGLH 81 +E F+++F DY+ Q EE ++ EL R +G TYLDY GS LYQ+ Q+ ++ D + Sbjct 38 HEILHSNFLKEFGNDYNKQVEEISRVELNRFKGQTYLDYTGSGLYQKSQLEEIYTDFINN 97 Query 82 TFGNAHSRNPSAKFTDERTREARELTLDFFGAREEEFAVVFTSGATAAVKLVGEDFPFSS 141 +GNAHSRNPSA+ T+++ EAREL +FF ++ ++FT GAT +KL+GEDFP++ Sbjct 98 AYGNAHSRNPSAELTNKKLSEARELLFNFFNISKDTHTIIFTGGATGGLKLIGEDFPWTK 157 Query 142 ASRFYYLRINHNSVLGVRELAYAAGAKAVKALS 174 S+FYY R+NHNSVLG+RE A + GA+ +ALS Sbjct 158 QSKFYYTRVNHNSVLGIREYAVSKGAE-FRALS 189 Lambda K H 0.318 0.132 0.366 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40