bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3298_orf1 Length=136 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G42390.1 60.1 2e-08 > 3702.AT5G42390.1 Length=1265 Score = 60.1 bits (144), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 0/80 (0%) Query 17 QLDGAKQQVLSRHLHDRKYARYWLDLLGGLQLADVPRKTPSYFSELERVVKSITMQDIHL 76 +LD AK+ +L RH + K YWL+LL LQ + VPRK S EL + ++ +++DI+L Sbjct 1148 ELDRAKRTLLMRHEAELKSNAYWLNLLAHLQASSVPRKELSCIKELVSLYEAASIEDIYL 1207 Query 77 LLRSLGLRRESMWEAIGVSG 96 L + +S++ IG++G Sbjct 1208 AYNQLRVDEDSLYSCIGIAG 1227 Lambda K H 0.318 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22513421946 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40