bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3199_orf1 Length=141 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP010192-PA 90.5 1e-17 > 7165.AGAP010192-PA Length=2077 Score = 90.5 bits (223), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 47/87 (54%), Positives = 56/87 (64%), Gaps = 6/87 (6%) Query 1 TTVNQGPAEIAFVFLGDQPNMPANAKRPPPSHQQKLRNAFKDFCTKCGEALTKNRQLVSG 60 TTVNQGP E+A VFL + AN P HQ KLR FKDF KC +AL KNR L+ Sbjct 1969 TTVNQGPMEMALVFLSNI----ANGNTIPTKHQNKLRLCFKDFSKKCADALKKNRNLILS 2024 Query 61 HEQQVEYHKELERNFYKFTERLAPVMS 87 Q +Y KELERN+ FTERLAP+++ Sbjct 2025 --DQKDYQKELERNYQVFTERLAPLIT 2049 Lambda K H 0.314 0.130 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22827922775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40