bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3155_orf1 Length=161 Score E Sequences producing significant alignments: (Bits) Value 5833.PFI1245c 165 5e-40 > 5833.PFI1245c Length=466 Score = 165 bits (417), Expect = 5e-40, Method: Compositional matrix adjust. Identities = 74/120 (61%), Positives = 90/120 (75%), Gaps = 0/120 (0%) Query 42 DTSNTTISYNVDVWLNKLFHCQRLMPTEIKCLLQLLQDILIKEPNCLCVRSPITIAGDIH 101 + S+ ISYNVD W+ KL C+ L E+K + LL DIL E NC+ + P+T+AGDIH Sbjct 151 NNSSGKISYNVDEWICKLLKCELLKIEEVKLMCDLLIDILKNEENCVRINVPVTVAGDIH 210 Query 102 GQFYDLLELFRVGGLPPTVSYLFMGDYVDRGFYSVEVFCLVAALKVKYPQSVYLLRGNHE 161 GQF+DLLELF +GGLPP V+YLF+GDYVDRG+YS E FCLVA K+KYP V LLRGNHE Sbjct 211 GQFFDLLELFHIGGLPPDVNYLFLGDYVDRGYYSCECFCLVACFKIKYPSRVTLLRGNHE 270 Lambda K H 0.323 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26764363279 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40