bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3066_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_360 155 4e-37 > 5807.cgd8_360 Length=252 Score = 155 bits (391), Expect = 4e-37, Method: Compositional matrix adjust. Identities = 77/125 (61%), Positives = 102/125 (81%), Gaps = 0/125 (0%) Query 5 IQQMVKFILNEAKDKAQEIEARALEDFNIEKLKLVQQMKDKIRQEFDKKAKKLEVQRPID 64 IQQM+ FILNEAKDKA EIEA+AL+DFNIEKLKLVQ K++IRQ+ KK K+LEV+R I Sbjct 28 IQQMINFILNEAKDKANEIEAKALQDFNIEKLKLVQSYKEQIRQDLKKKVKRLEVERAIA 87 Query 65 RSTAINKARLRRIAAQEQVVTEVYSQSQKQLAAICSDTAKYKELLVDLIVQGLLRLLESE 124 RSTAINKARL+++AA+ QV+TEV Q++K++ I ++ Y+ LLVDL+ Q +L+LLE Sbjct 88 RSTAINKARLKKMAARAQVLTEVVQQTRKKMCEISTNPTVYEPLLVDLLTQAMLKLLEPT 147 Query 125 VIIRC 129 VI++C Sbjct 148 VIVKC 152 Lambda K H 0.317 0.132 0.350 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40