bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_3050_orf1 Length=147 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_4160 144 7e-34 > 5807.cgd7_4160 Length=637 Score = 144 bits (363), Expect = 7e-34, Method: Composition-based stats. Identities = 69/140 (49%), Positives = 92/140 (65%), Gaps = 4/140 (2%) Query 1 RTL-LWMDEYADLAWRVLGRPNVDYGAESLKQRQEWRKQHNCKSFRWYMENVFPEADVVH 59 RTL LWMDE+ DLAWRV+GRP VD G L +R + R++ C SF+W++ENV PEA+V Sbjct 428 RTLYLWMDEFGDLAWRVMGRPRVDTGP--LDERIKLRERLRCNSFKWFLENVNPEAEVKS 485 Query 60 LDDVPYLGQLENVASGLCMDSVGRASPGGRPALKPCAPGHATQEFMYFRKIGHVMPVHND 119 +DDVPY+G ++N+ S LC+D+ G +PGG+ L C G TQ FMYF+ H M ND Sbjct 486 IDDVPYIGNIKNIGSNLCIDTDGFNNPGGKVKLWSCHTGE-TQNFMYFKTSKHWMVTIND 544 Query 120 EACLTPRGDWDWCRATDPMW 139 E+C+T + DWC W Sbjct 545 ESCITEKFKLDWCNEHSYHW 564 Lambda K H 0.322 0.139 0.490 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23033159460 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40