bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2994_orf1 Length=106 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G03430.1 89.0 4e-17 > 3702.AT5G03430.1 Length=497 Score = 89.0 bits (219), Expect = 4e-17, Method: Composition-based stats. Identities = 46/99 (46%), Positives = 63/99 (63%), Gaps = 6/99 (6%) Query 6 PI-AFVLGTRNTDPCAQGEELYPIQLSSNWLPPFLRIQPLLQFAYGHIWWLLLQQQLPYC 64 PI A LG R DP A G+E + S W PPF+R+ P+L ++Y +W LL ++ YC Sbjct 126 PIRAIFLGVRIGDPTAVGQEQFSPS-SPGW-PPFMRVNPILDWSYRDVWAFLLTCKVKYC 183 Query 65 SLYDQGYTSIGNMENTRPNPLLFIK---KEKKYLPAYKL 100 SLYDQGYTSIG++ +T PN LL + ++K+ PAY L Sbjct 184 SLYDQGYTSIGSIHDTVPNSLLSVNDTSSKEKFKPAYLL 222 Lambda K H 0.322 0.142 0.474 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22605445551 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40