bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2988_orf1 Length=103 Score E Sequences producing significant alignments: (Bits) Value 5833.PFB0260w 130 2e-29 > 5833.PFB0260w Length=969 Score = 130 bits (326), Expect = 2e-29, Method: Composition-based stats. Identities = 61/101 (60%), Positives = 83/101 (82%), Gaps = 0/101 (0%) Query 1 PQLIDLLSKLSHDADPDTALNAIFAMGILGAGTNHSRIASLLRQLASYYGKDPSALFVVR 60 P ++D+LSKL+HD DPD AL+AI ++G +GAGTN+SRIA LLRQL+++Y KD +A+FVVR Sbjct 758 PNIVDILSKLTHDQDPDVALHAIISLGFVGAGTNNSRIAILLRQLSAFYCKDTNAIFVVR 817 Query 61 LSQGLLYLGKGLLHIGALHSDRQLICRVALGALAIVSYSAL 101 L+QGLLY+GKGLL I LHS+R +I V+LG+L I ++ L Sbjct 818 LAQGLLYMGKGLLTINPLHSNRSIINYVSLGSLLITIHACL 858 Lambda K H 0.325 0.140 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22836390219 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40