bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2968_orf1 Length=133 Score E Sequences producing significant alignments: (Bits) Value 10090.ENSMUSP00000019995 105 4e-22 > 10090.ENSMUSP00000019995 Length=730 Score = 105 bits (262), Expect = 4e-22, Method: Composition-based stats. Identities = 54/134 (40%), Positives = 79/134 (58%), Gaps = 4/134 (2%) Query 1 FPSEPTWMVSVDVTDDEKFIVASISRSCEPTNKLWIAALPDGTVPSTAFSKLQWVKVADD 60 FP EP WM +++DD ++++ SI C+P N+LW L P+ L+WVK+ D+ Sbjct 228 FPDEPKWMGGAELSDDGRYVLLSIWEGCDPVNRLWYCDLQQE--PNGITGILKWVKLIDN 285 Query 61 FEAGFDYVANDGTIFLLKTNRDAPKNKIVKVDVAKPDAPMVDV-VPE-AGAVLEDVMVVA 118 FE +DYV N+GT+F KTNR++P +++ +D PD V VPE VLE V V Sbjct 286 FEGEYDYVTNEGTVFTFKTNRNSPNYRLINIDFTDPDESKWKVLVPEHEKDVLEWVACVR 345 Query 119 GDKMVLHYNEDVKS 132 + +VL Y DVK+ Sbjct 346 SNFLVLCYLHDVKN 359 Lambda K H 0.316 0.132 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22766716098 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40