bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2913_orf2 Length=118 Score E Sequences producing significant alignments: (Bits) Value 7159.AAEL003453-PA 87.0 1e-16 > 7159.AAEL003453-PA Length=300 Score = 87.0 bits (214), Expect = 1e-16, Method: Compositional matrix adjust. Identities = 44/120 (36%), Positives = 70/120 (58%), Gaps = 4/120 (3%) Query 2 WIVRWWRYNHPQEFLDTAQLDIKRTFNSRFPNSILNFVFKIGF-RKHLKDAVGYGVGRFT 60 W++ +WR +P + + +++++ SR PN++LNF+FK F RK K G+G Sbjct 85 WVLLFWRSKNPDQMIKGYKVNLQHALGSRLPNAVLNFLFKFQFGRKGAKKVKAQGLGVHK 144 Query 61 EAEVIQAAQEDLTALSTLLGTKAYFFGKEPHSLDITAFSHLAQLLYVPFA---GLKEWVE 117 E+ + ++DL LS LL K +FFG EP +LD AFS LAQ+ Y+ LKE+++ Sbjct 145 PEEIEEFGKQDLKVLSELLADKPFFFGDEPTTLDCVAFSVLAQVHYISDEVKYALKEYMQ 204 Lambda K H 0.325 0.139 0.444 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22460540320 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40