bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2892_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0042 135 3e-31 > 5833.PF13_0042 Length=561 Score = 135 bits (341), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 64/117 (54%), Positives = 84/117 (71%), Gaps = 7/117 (5%) Query 1 DKKWRLYLFKKENRKSAASADEEPTKVLHIHRSMNYLFGKDERVVDILLRHPTISKQHAI 60 DKKWRLY+FK S + EP K+LHIH YL GK++ VDI L + +ISKQHA+ Sbjct 446 DKKWRLYMFK-------DSNNNEPQKILHIHDKSYYLIGKEQLAVDIQLNNISISKQHAV 498 Query 61 IQFRKTIKGILPYLIDLESTNGSYLNDKRVDTARYIELREGDTLRFGKSSREFVLLH 117 IQF+K ILP+L+DL STNG+Y+N++++ +Y ELRE D +RFG S+REFVLLH Sbjct 499 IQFKKHESKILPFLLDLNSTNGTYINNEKIQPNKYYELRETDIIRFGSSNREFVLLH 555 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40