bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2874_orf2 Length=132 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_3440 201 5e-51 > 5807.cgd3_3440 Length=683 Score = 201 bits (511), Expect = 5e-51, Method: Compositional matrix adjust. Identities = 96/132 (72%), Positives = 112/132 (84%), Gaps = 0/132 (0%) Query 1 LSSDRLALQRLREAAETAKIELSSKLSTEVSLPFITADSNGPKHLQVHLSRAQLEQLVQP 60 LS D+LALQRLREA+ETAK ELSSK E++LPFITAD+ GPKHLQ+ LSRA+ E+LV Sbjct 296 LSRDKLALQRLREASETAKKELSSKTQVEINLPFITADARGPKHLQIKLSRAKYEELVDD 355 Query 61 LLQQSVEPCEKCIRDAGVTKGDISDVILVGGMTRMPKVGEVVRSIFNREPSKGVNPDEAV 120 LL++++ P EKCIRD+G+ K I+DVILVGGMTRMPKV E V+ IF REPSKGVNPDEAV Sbjct 356 LLKKTISPSEKCIRDSGIPKEKINDVILVGGMTRMPKVSETVKKIFGREPSKGVNPDEAV 415 Query 121 AAGAAIQAGVLK 132 A GAAIQAGVLK Sbjct 416 AMGAAIQAGVLK 427 Lambda K H 0.314 0.130 0.352 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851147482 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40