bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2858_orf1 Length=93 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP001519-PA 93.2 2e-18 > 7165.AGAP001519-PA Length=2146 Score = 93.2 bits (230), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 44/81 (54%), Positives = 58/81 (71%), Gaps = 0/81 (0%) Query 9 YRPTTRVTNQVYEQLLVVLQQQLGDRPDEVLRGAADEVLQVLKEDGLKEGERKRGVEGVL 68 YRP T+ T Q YE LL +Q+ +GD+P ++LRGAADE+L VLK D +KE E+KR ++G+L Sbjct 102 YRPKTQETRQTYEVLLSFIQEAIGDQPRDILRGAADEILAVLKNDRMKEREKKREIDGLL 161 Query 69 GPITQERFTKLFQLSKSITDF 89 G + ERF L L K ITDF Sbjct 162 GSVADERFALLVNLGKKITDF 182 Lambda K H 0.317 0.137 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22770216990 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40