bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2761_orf1 Length=138 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0239 109 3e-23 > 5833.PF11_0239 Length=1617 Score = 109 bits (272), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 47/90 (52%), Positives = 66/90 (73%), Gaps = 0/90 (0%) Query 1 QIRQINEIFRKLDKDGDGTISHCELTEGLAQVGLPQWDINRIIQSIDVDDSGNVSYTEFL 60 I+ INE+F KLD + +G++SH E+ LA VG+ +WDINRI+Q++D++D GN++YTEF+ Sbjct 1474 HIKYINELFYKLDTNHNGSLSHREIYTVLASVGIKKWDINRILQALDINDRGNITYTEFM 1533 Query 61 AACYSWKESELNVIWTAFQKMDKDGDGKIS 90 A CY WK E + AF K+DKD DG IS Sbjct 1534 AGCYRWKNIESTFLKAAFNKIDKDEDGYIS 1563 Lambda K H 0.317 0.138 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40