bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2694_orf3 Length=134 Score E Sequences producing significant alignments: (Bits) Value 3702.AT3G44600.1 64.7 7e-10 > 3702.AT3G44600.1 Length=631 Score = 64.7 bits (156), Expect = 7e-10, Method: Composition-based stats. Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 1/94 (1%) Query 41 TTALAIAASPNGQWLAVLGADFHLRIFGVRRAKLSRVYLETLQYYEMAQKDPQCALLHQD 100 TT AI SP+G+ ++ D +R+F R KL RVY E+L + Q+ L + Sbjct 260 TTISAIEVSPDGKQFSITAPDRRIRVFWFRTGKLRRVYDESLVVAQDLQRS-DAPLYRLE 318 Query 101 ALDFEQRAALEKELSRSPLRLHQNLLFDSSSSFL 134 A+DF +R A+EKEL ++ N +FD SS+FL Sbjct 319 AIDFGRRMAVEKELEKTESAPQPNAVFDESSNFL 352 Lambda K H 0.322 0.135 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682284714 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40