bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2677_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_1670 147 7e-35 > 5807.cgd7_1670 Length=1132 Score = 147 bits (372), Expect = 7e-35, Method: Compositional matrix adjust. Identities = 70/148 (47%), Positives = 101/148 (68%), Gaps = 3/148 (2%) Query 1 FETTAARNKYMSAVILGAFKIIKTRTGLTDDLCYHEFCRLIGKINTSHHLSELCASEPFR 60 F T A R + ++A++ G II+T+ GL + CYHE CRL+GK+NT++ L+EL +SE F Sbjct 283 FPTQADRTRSLAALMTGTAGIIQTKMGLEHESCYHELCRLLGKLNTANQLTELSSSEAFG 342 Query 61 EFPQYLFDFTMESLRSWERLPNSKHYLLGVWAHVISPLLFYKQKVPNDLELYIERITAAF 120 + +++FT++SL W LPNSKHYLLG+W+H++ PLL+ + P +LE YI IT F Sbjct 343 LWIDQVYNFTIKSLEEWSVLPNSKHYLLGLWSHMVIPLLYQGDRAPQNLEKYIHHITVTF 402 Query 121 IMSRMCVAEAIADDADNCDWESPLTNDV 148 I SRM +AEAIA + D E PL ++V Sbjct 403 IQSRMKLAEAIARGS---DVEDPLESEV 427 Lambda K H 0.325 0.137 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40