bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2648_orf1 Length=146 Score E Sequences producing significant alignments: (Bits) Value 5833.PFD0895c 132 2e-30 > 5833.PFD0895c Length=187 Score = 132 bits (333), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 61/95 (64%), Positives = 75/95 (78%), Gaps = 0/95 (0%) Query 52 MSKEKYQKQWEAISHKIEKANSELLCLSYGSLVSQLLKDFEQVEAVNAQLEKMGYNIGVR 111 MSK+KYQKQ +AI K+EK NSEL +YG+LVSQLLKD E V+ VN QLEKMG+NIG R Sbjct 1 MSKDKYQKQGDAIFAKLEKVNSELFSFTYGALVSQLLKDLELVDEVNEQLEKMGFNIGTR 60 Query 112 LVDEFLAKANIGACESFRETAEVIAKLGLRMFLGV 146 L++EFLAK++I CE F ET VIAK+ +MFLG+ Sbjct 61 LIEEFLAKSDISFCEDFEETVNVIAKVAFKMFLGI 95 Lambda K H 0.317 0.126 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22393349475 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40