bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2622_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP000363-PA 189 1e-47 > 7165.AGAP000363-PA Length=1007 Score = 189 bits (481), Expect = 1e-47, Method: Compositional matrix adjust. Identities = 89/172 (51%), Positives = 120/172 (69%), Gaps = 20/172 (11%) Query 1 GDGWDMMLRHPAKKKLTANRYWKKIFVRFI--PETCMLQLYNKKEDPQPFQELPLQASYS 58 GDGW+M LR P KKK+T R+WKKI++R + ++ +LQL N D +PFQELPLQA YS Sbjct 592 GDGWEMQLRQPNKKKITGQRFWKKIYIRLVYQGDSPVLQLLNAATDKEPFQELPLQACYS 651 Query 59 LSEISAQQYDQYGKIFTIKVQYIFYRERVGVRPGQIAK--------------VMQGQIQS 104 +SEI AQQYD +GKIFTIK+QY+FY+ER GVRPGQ+ K +QG Q Sbjct 652 VSEIGAQQYDNFGKIFTIKLQYVFYKERPGVRPGQVTKAERLTNKLSQFAAYAIQGDYQG 711 Query 105 M----GDFARLGMPVEHAPQVSELLKIGTLDYLTLKEMVTVVEEAMFRMNVH 152 + D +LG+PVEHAPQ+S+L K+G+++Y +K+ +EEA+F+MNVH Sbjct 712 VKELGSDLKKLGLPVEHAPQISQLFKLGSMNYEDMKQFSVCIEEALFKMNVH 763 Lambda K H 0.323 0.137 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40