bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2604_orf1 Length=130 Score E Sequences producing significant alignments: (Bits) Value 9258.ENSOANP00000026637 130 2e-29 > 9258.ENSOANP00000026637 Length=654 Score = 130 bits (326), Expect = 2e-29, Method: Compositional matrix adjust. Identities = 62/127 (48%), Positives = 84/127 (66%), Gaps = 0/127 (0%) Query 1 NPSDKGWLVYIHFEERCRELERARRIFERYLSNRPSQEAFLRFCKFEEKHKNIPRARAGY 60 NP DK W++Y+ FE+RC E +R R I +R++ +RPS +AFL+F KFEE NI RARA + Sbjct 163 NPQDKSWMLYVKFEQRCNEPQRCRDILQRFVESRPSCDAFLKFVKFEESTNNIARARAVF 222 Query 61 EKAIELLPEDLLNEHFYMKFAAFEERQQEKERAKAIYEAALQRVPRGQADELYSKYVSFQ 120 IE LP D ++E F++KFAAFEER A+ +Y+ L +P+ A+ LY KY SFQ Sbjct 223 LACIETLPHDQMHEEFFIKFAAFEERHHNIAGAERVYQQGLTILPKCYAEALYQKYTSFQ 282 Query 121 KQFGEHE 127 KQ E Sbjct 283 KQHKSKE 289 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23020010250 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40