bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2472_orf1 Length=115 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE1545c 143 2e-33 > 5833.PFE1545c Length=2675 Score = 143 bits (360), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 67/123 (54%), Positives = 99/123 (80%), Gaps = 8/123 (6%) Query 1 FWDPIYEDDVPGTLFQKEEPF----PVKEEDVEETFAKVAPKA----KTEIKKPKVLQLL 52 FW+ ++E+D+PGTLF+ ++ F +++E+VE++FAK K +T+IKKPKV+QLL Sbjct 2256 FWEALFENDIPGTLFEDKKEFITKIAIEKENVEKSFAKAVSKKDNEKETKIKKPKVIQLL 2315 Query 53 PDSKRAYNMNIALAKFSNYSYQELREAIIDLNPKILTVEATESLLNLVPTPEELAVMKEY 112 PDSKR YNM+IAL+KF+NY+++E+R+AI++LNPKIL ++ TE LL VPTPEE ++KEY Sbjct 2316 PDSKREYNMSIALSKFNNYTFKEIRDAIMELNPKILNIDNTEVLLQYVPTPEEFEIVKEY 2375 Query 113 INS 115 I+S Sbjct 2376 IHS 2378 Lambda K H 0.312 0.132 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22698934816 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40