bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2457_orf1 Length=119 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G18620.2 61.6 6e-09 > 3702.AT5G18620.2 Length=1072 Score = 61.6 bits (148), Expect = 6e-09, Method: Composition-based stats. Identities = 34/100 (34%), Positives = 56/100 (56%), Gaps = 7/100 (7%) Query 1 FTEEEDIFVLNLTTLLGYGNWEKLRSQILRDSNWVGDWFFRSRAAADLGRRAEAIIRQLK 60 + EE D F++ + LGYGNW++L++ + DWF +SR +L RR + +IR ++ Sbjct 952 YNEECDRFMICMVHKLGYGNWDELKAAFRTSPLFRFDWFVKSRTTQELARRCDTLIRLIE 1011 Query 61 KE-----EGERFSRGRRRLDMPATKQQSPSA--ATGTPAA 93 KE E ER +R ++L AT + PS A +P++ Sbjct 1012 KENQEFDERERQARKEKKLSKSATPSKRPSGRQANESPSS 1051 Lambda K H 0.314 0.127 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22381075488 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40