bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2295_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 59463.ENSMLUP00000014538 61.2 7e-09 > 59463.ENSMLUP00000014538 Length=652 Score = 61.2 bits (147), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 45/125 (36%), Positives = 67/125 (53%), Gaps = 12/125 (9%) Query 16 SSAAAPAPPATPAAPAAERSSWRLGEDLARQFQRTEQLRGDAKYFCPQCGDKREARKRLQ 75 + +A+P P T AAP+ E S L DL F E+L + +Y+C C +EA K ++ Sbjct 374 NDSASPGP-ETQAAPSGEGSRSVL--DLVNYFLSPERLEEENRYYCESCASLQEAEKVVE 430 Query 76 LSLLPPYLQVVVLRYSIDVRKQTGEVARRKLHEALEVPLVMEL-----KAGLADKCRVAL 130 LS P YL + +LR+S D+R + RRK+ E + VPL++ L +A D C V + Sbjct 431 LSQGPRYLILTLLRFSFDLRT----MRRRKILEDVAVPLLLRLPLAGGRAQAYDLCSVLV 486 Query 131 PLGGS 135 G S Sbjct 487 HSGVS 491 Lambda K H 0.316 0.130 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40