bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2226_orf1 Length=172 Score E Sequences producing significant alignments: (Bits) Value 5270.UM02245.1 83.6 2e-15 > 5270.UM02245.1 Length=364 Score = 83.6 bits (205), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 52/157 (33%), Positives = 80/157 (50%), Gaps = 23/157 (14%) Query 13 LASGGADNRVRLWECD-ASKQWTELPALAGEHHTDWVRDVSFRPQGASSFVVPGALLLAS 71 AS G DN V++WE + ++ E+ AL G H+DWVRDV+F P +P + LA+ Sbjct 228 FASAGCDNTVKIWEFSQEANRFVEVEALQG--HSDWVRDVAFAPN----VGLPRS-YLAT 280 Query 72 CSEDKTVKLWIGEPPQQQQHQQQQQQLQQQQQQDILMNNPSPSQYKWRLLQTLVLDAPAW 131 S+D+TV +W + P + + N + T+ W Sbjct 281 ASQDRTVLIWTQDSPTAAWSKTALNPISASAAAGAGSN---------KFPDTV------W 325 Query 132 RVTWSSSGALLAVACGDSAVLLLRENMHGTWELVTDL 168 RV+WS SG +LAV+CGD + L +EN+ G WE V+++ Sbjct 326 RVSWSVSGNVLAVSCGDGKITLWKENLKGAWECVSEM 362 Lambda K H 0.315 0.128 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 32857020181 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40