bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2211_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 5141.NCU00467.1 127 8e-29 > 5141.NCU00467.1 Length=336 Score = 127 bits (320), Expect = 8e-29, Method: Compositional matrix adjust. Identities = 60/122 (49%), Positives = 77/122 (63%), Gaps = 1/122 (0%) Query 10 QKVVGWYHSHPNYGCWLSGIDVCTQQLQQQHQDPFLAIVVDPIRTVCNRSIELGGFRTLL 69 + V+GWYHSHP YGCWLSGIDV TQ LQQQ +PF+A+V+DP RTV +E+G FRT + Sbjct 120 ENVIGWYHSHPGYGCWLSGIDVGTQSLQQQFNEPFVAVVIDPDRTVSQNKVEIGAFRT-I 178 Query 70 PGEEKRDDAGDAEAASSQLLPAEKVNDFGAHWKRYYQLRVHWCANSISAPLLEQMCSASW 129 P K A + Q +P KV DFGAH RYY L V +++ + LLE + + W Sbjct 179 PEGIKPFAATNTTTGDGQSVPLNKVEDFGAHSHRYYALDVEHFKSTLDSKLLETLWNKYW 238 Query 130 PQ 131 Q Sbjct 239 VQ 240 Lambda K H 0.319 0.133 0.439 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40