bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2197_orf1 Length=113 Score E Sequences producing significant alignments: (Bits) Value 10116.ENSRNOP00000021923 98.2 6e-20 > 10116.ENSRNOP00000021923 Length=1361 Score = 98.2 bits (243), Expect = 6e-20, Method: Compositional matrix adjust. Identities = 49/115 (42%), Positives = 69/115 (60%), Gaps = 12/115 (10%) Query 1 VLQSLATFAKTHPGPGMARPKLLPPSEDEEPVLILRNARHPIAEK--LTENFVPNDVMLN 58 VL LA++++ GP M RP LL P ED P L L+ +RHP K ++F+PND+++ Sbjct 1059 VLLCLASYSQGGDGP-MCRPVLLLPGEDTHPFLELKGSRHPCITKTFFGDDFIPNDILIG 1117 Query 59 VPADYSSSSNSSSSSSSSKTRTLLITGPNMGGKSTLLRQTALCVILAQLGSYVPA 113 D + + K +L+TGPNMGGKSTL+RQ L ++AQ+G YVPA Sbjct 1118 CEED---------AEADGKAYCVLVTGPNMGGKSTLIRQAGLLAVMAQMGCYVPA 1163 Lambda K H 0.311 0.127 0.353 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22857864480 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40