bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2159_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value 392499.Swit_2055 162 3e-39 > 392499.Swit_2055 Length=410 Score = 162 bits (410), Expect = 3e-39, Method: Compositional matrix adjust. Identities = 87/113 (76%), Positives = 101/113 (89%), Gaps = 1/113 (0%) Query 1 EHRAHGVEIHLNAKMDCLIGHD-GWVTGVRMSDGSVLPADMVVVGIGIVPAVEPLIAAGA 59 EHRAHGV++ L AK+DC++G D VTGV+M DGSV+PADMV+VGIGI+PAVEPLIAAGA Sbjct 196 EHRAHGVDVQLGAKVDCIVGDDQDRVTGVQMHDGSVIPADMVIVGIGIIPAVEPLIAAGA 255 Query 60 ASGNGVEVDEFCQTSLPNIYAIGDCAIHANPFAGGQRIRLESVQNANDQAITA 112 A GNGV+VDE+C+TSLP+IYAIGDCA+HAN FA G RIRLESVQNANDQA TA Sbjct 256 AGGNGVDVDEYCRTSLPDIYAIGDCAMHANAFAEGARIRLESVQNANDQATTA 308 Lambda K H 0.319 0.136 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22937329312 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40