bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2056_orf1 Length=149 Score E Sequences producing significant alignments: (Bits) Value 5833.PFB0210c 86.3 2e-16 > 5833.PFB0210c Length=504 Score = 86.3 bits (212), Expect = 2e-16, Method: Composition-based stats. Identities = 43/92 (46%), Positives = 60/92 (65%), Gaps = 2/92 (2%) Query 44 QFVLVAVLGSFQFGYSFSSLNTSKAIIIVDFDWCKNDPDHVLDCSNGVLYGSLITTAVFV 103 ++VL A + SF FGY S LNT K I+V+F+WCK + D L+CSN + S + +VF+ Sbjct 28 KYVLSACIASFIFGYQVSVLNTIKNFIVVEFEWCKGEKDR-LNCSNNTIQSSFLLASVFI 86 Query 104 GLMFGCLLAGPVTNFGRRVSLLLT-NLLFLVS 134 G + GC +G + FGRR+SLL+ N FLVS Sbjct 87 GAVLGCGFSGYLVQFGRRLSLLIIYNFFFLVS 118 Lambda K H 0.325 0.138 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22854363588 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40