bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2028_orf1 Length=139 Score E Sequences producing significant alignments: (Bits) Value 7719.ENSCINP00000001692 167 1e-40 > 7719.ENSCINP00000001692 Length=1017 Score = 167 bits (422), Expect = 1e-40, Method: Compositional matrix adjust. Identities = 79/124 (63%), Positives = 97/124 (78%), Gaps = 0/124 (0%) Query 15 KAMLVEIDISQSAYANARRMHSHRKDAAKKEQKTIDHSEKAFKNVERKVKQQLKETTIKS 74 K +EID+S SAYANAR+ + +++AAKKEQKTID S KAFK+ E+K KQ LKE Sbjct 419 KPTKIEIDLSLSAYANARKYYGRKRNAAKKEQKTIDASTKAFKSAEKKTKQTLKEAAAVR 478 Query 75 NIVMARKVLWFEKFFWFISSEGFLVIGGRDAQQNELIVKRYLAKDDIYVHADIHGATSIV 134 NI+ ARKV WFEKF WFISSE +LVIGGR+AQQNE++VK+YL + DIYVHAD+HGATS + Sbjct 479 NILKARKVYWFEKFLWFISSENYLVIGGREAQQNEVLVKKYLNQGDIYVHADLHGATSCI 538 Query 135 FLPP 138 P Sbjct 539 IKNP 542 Lambda K H 0.320 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40