bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2005_orf1 Length=124 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P1.9 87.8 9e-17 > 5833.MAL3P1.9 Length=1254 Score = 87.8 bits (216), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 42/97 (43%), Positives = 59/97 (60%), Gaps = 0/97 (0%) Query 4 DPRALLDPNLPFNEAAVNLLDRVVAAMFLSNDSVERDVAHRVLGEFKNMPNAWTHVAFIL 63 +P +LLD N F+ + LLD VV A+ + D RD A +L +FK + +W V+ IL Sbjct 7 NPLSLLDKNQAFDAEKLKLLDNVVEALLDTKDKNRRDFAQNLLNQFKMLDTSWRSVSIIL 66 Query 64 NVSKDPNTKFFALQILEATITNRWNVLPETERNSTKS 100 S++ NTKF+ LQILE I NRWN+LP E+ K+ Sbjct 67 EHSENVNTKFYGLQILEECINNRWNILPSEEKEGMKN 103 Lambda K H 0.320 0.132 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22752691665 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40