bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_2004_orf1 Length=152 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P1.9 116 2e-25 > 5833.MAL3P1.9 Length=1254 Score = 116 bits (291), Expect = 2e-25, Method: Compositional matrix adjust. Identities = 52/160 (32%), Positives = 100/160 (62%), Gaps = 13/160 (8%) Query 1 RDELTKQFKELYNVCIFVLKSFISSPHGGIKITLIQQTLKCLAHFLKWIPLGFVFET--- 57 R+E QF+E+YN+C+++L++ + + +LI+QTL CL++F KWIPL ++F+ Sbjct 194 RNEYASQFQEVYNLCLYILEANVYNKRST-NTSLIKQTLHCLSNFFKWIPLTYIFDKYKF 252 Query 58 -----ELLPLLLQYFYEDVSFRIDCLRCLTEVSSLQLNINELNLFSQQMTLLWAQLSDKA 112 +++ LL +F++D+S++I+C++C+ E+ L+++ + F LW +L K Sbjct 253 NDNNIQIIDLLFDHFWDDISYKIECVKCIQEIVMLKIDEKNILYFDNVFINLWTKLVSKI 312 Query 113 AHTPKQSLQYNDPTSVPPQVRLFWETTFCQLELCLTAFLR 152 P N+ ++PP++++FWE F QL +C+T+FL+ Sbjct 313 KLLPNA----NEMKNIPPELKIFWEQYFLQLSICITSFLK 348 Lambda K H 0.327 0.140 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22586169780 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40