bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1882_orf1 Length=95 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.109 115 3e-25 > 5833.MAL8P1.109 Length=545 Score = 115 bits (289), Expect = 3e-25, Method: Composition-based stats. Identities = 49/92 (53%), Positives = 73/92 (79%), Gaps = 1/92 (1%) Query 3 AEKKRIEAAGGEVLRLDCDIPHRVFVKDHLFPGLAMSRAIGDGIAHQIGVVSEPEIAQVP 62 AEKKRI ++GG+V++L+ DIP+RVF+K+ +PGLAMSRAIGD I HQIG+++EP+ +V Sbjct 408 AEKKRILSSGGQVMKLEGDIPYRVFIKNKFYPGLAMSRAIGDTIGHQIGIIAEPDFIEVN 467 Query 63 LDE-SSLFFIVASDGIWELISSEEAVTIVSSY 93 ++E + ++ SDG+WE ISSEEAV ++ + Sbjct 468 INEDEDILVLICSDGVWEFISSEEAVNLIYEF 499 Lambda K H 0.319 0.137 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22621220430 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40