bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1796_orf1 Length=148 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P4.14 133 2e-30 > 5833.MAL3P4.14 Length=432 Score = 133 bits (334), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 57/122 (46%), Positives = 83/122 (68%), Gaps = 0/122 (0%) Query 27 TIKLDYWEIGLHGMKINGKSFGVCEKRGCRAAVDTGSSLITGPSSVINPLIKALNVAENC 86 I L YWEI L ++++ K+ +CE + CRAA+DTGSSLITGPS+ I PL++ +N+ +C Sbjct 282 VISLYYWEINLLDIQLSHKNLFLCESKKCRAAIDTGSSLITGPSTFIQPLLEKINLERDC 341 Query 87 SNLGTLPTLTFVLKDIYGRLVNFSLAPRDYVVEELDARGNPNNCAAGFMAMDVPAPRGPL 146 SN +LP ++FVLK++ G+ + P DY++EE D N C G M +DVP PRGP+ Sbjct 342 SNKESLPIISFVLKNVEGKEITLDFMPEDYIIEEGDTENNTLECVIGIMPLDVPPPRGPI 401 Query 147 FV 148 F+ Sbjct 402 FI 403 Lambda K H 0.319 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22943761524 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40