bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1740_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 9031.ENSGALP00000039226 147 6e-35 > 9031.ENSGALP00000039226 Length=863 Score = 147 bits (372), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 71/136 (52%), Positives = 93/136 (68%), Gaps = 1/136 (0%) Query 1 FQGKYGDLDASLLSYGPCQTPTLQLCVHRSDAINSFTPETYYYIDAAVSVGGQE-IHMNW 59 FQGKYG+LD+SL+S+GPCQTPTL CV R D I SF PETY+ + A V+ + + ++W Sbjct 200 FQGKYGNLDSSLISFGPCQTPTLGFCVERHDKIQSFKPETYWVLQAKVNPEKESSLTLDW 259 Query 60 SRRQVFDLSVAQTFLAIVSEGIGGKCESIKETEEIICMPKALNTVELLKAASNRLGIGPH 119 R +VFD +AQ FL I K ES+ + E++ P ALNTVE+L+ AS LG+GP Sbjct 260 DRVRVFDREIAQMFLNITKMAKEAKVESVSKKEKVKQRPLALNTVEMLRVASAALGMGPQ 319 Query 120 RAMQIAERLYLGGFIT 135 AMQIAERLY G+I+ Sbjct 320 HAMQIAERLYTQGYIS 335 Lambda K H 0.321 0.136 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40