bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1734_orf1 Length=122 Score E Sequences producing significant alignments: (Bits) Value 323259.Mhun_0018 113 1e-24 > 323259.Mhun_0018 Length=625 Score = 113 bits (283), Expect = 1e-24, Method: Compositional matrix adjust. Identities = 60/115 (52%), Positives = 82/115 (71%), Gaps = 1/115 (0%) Query 1 PEYPGAYKVDNIISVAATDEHDRLANFSNYGVNAVHIAAPGVFIVSTFPPNTIKSLSGTS 60 P+YP A+ NI+SVAATD +D+LA+FSNYG N+V +AAPGV I ST T + LSGTS Sbjct 381 PQYPAAFTSSNILSVAATDYNDKLASFSNYGPNSVDLAAPGVSIYSTSKSGTYQYLSGTS 440 Query 61 MATPVVSGIAAMLLSLRP-MRVQEIKEIIFTTADKPRTLKDKLRTGGRVSAAYAI 114 MATP VSG+AA++ S P M +I+ IF++ D +L K+ +GGR++AA A+ Sbjct 441 MATPHVSGVAALIKSQNPSMSATQIRSRIFSSVDTISSLSGKVGSGGRLNAAKAL 495 Lambda K H 0.318 0.132 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22916587881 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40