bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1721_orf1 Length=129 Score E Sequences producing significant alignments: (Bits) Value 44689.DDB_0191423 60.8 1e-08 > 44689.DDB_0191423 Length=699 Score = 60.8 bits (146), Expect = 1e-08, Method: Composition-based stats. Identities = 36/114 (31%), Positives = 64/114 (56%), Gaps = 6/114 (5%) Query 6 FSPWGPWQTLCTVYVLSLSWVVLFSLFSVFNKCKDAVALRLYFRSRLYIHCDTALQLMGW 65 FS P + + + SL W L LFS F+ K + ++++ L I+ D +Q + W Sbjct 140 FSAPIPIWLMVFLVIFSLYW--LSKLFSFFSSIKTNWEISSFYKNTLKINEDD-IQTIEW 196 Query 66 PEVAALLLRAQQQHPFCLVKQNLSVLDLVSVIMRRDNYIIALTNKEVLGRALPL 119 EV + ++ + C+VK+N++ LD+ + IMR++NYII L N+ +L ++P Sbjct 197 REVVSKIVLVPR---LCIVKENMNALDIANRIMRKENYIIGLINQRILNLSIPF 247 Lambda K H 0.330 0.141 0.459 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22342951125 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40