bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1693_orf1 Length=154 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL3P4.14 86.7 2e-16 > 5833.MAL3P4.14 Length=432 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 51/159 (32%), Positives = 83/159 (52%), Gaps = 15/159 (9%) Query 2 YIDSMTGREVL-------HLQKVKLHDYAIGFVVRQAEYPFSELPFDGIAGLGHP----- 49 YI TG +L +L+ +K+ IG + ++ +PFS+LPFDGI GLG Sbjct 164 YIQYGTGTSILEQSYDDVYLKGLKIKHQCIGLAIEESLHPFSDLPFDGIVGLGFSDPDFR 223 Query 50 HNVQESSSLIKQLVEAGAIKLAMFAIALPLSASSAGEVTFGGFNRHYIQKGVAIAWFPLL 109 + +S LI+ + + +K +F+ +P +G +TFG N+ Y +G +I WFP++ Sbjct 224 SQNKYASPLIETIKKQNLLKRNIFSFYVPKKLEKSGAITFGKANKKYTVEGKSIEWFPVI 283 Query 110 SKQSNRWELWLWDVLVDDATVGFCTPQLPCIAVIDTGTS 148 S WE+ L D+ + + C + C A IDTG+S Sbjct 284 SLY--YWEINLLDIQLSHKNLFLCESK-KCRAAIDTGSS 319 Lambda K H 0.321 0.139 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23121682173 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40