bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1663_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value 7165.AGAP008516-PA 117 1e-25 > 7165.AGAP008516-PA Length=519 Score = 117 bits (293), Expect = 1e-25, Method: Composition-based stats. Identities = 52/91 (57%), Positives = 64/91 (70%), Gaps = 0/91 (0%) Query 1 LCRHPFQESKRCFVKPKKVEKLLNVWWEKGTITKDLPSLAEIRAHVQTSLNKVRFDMLRL 60 LCRHPFQESKR +V P +VE L V+W +G + + LPSL E+R VQ SL +R D R Sbjct 428 LCRHPFQESKRAYVIPTQVEPLYRVYWAEGRVAQVLPSLEEVRERVQASLRTLRQDHKRT 487 Query 61 YNATPYKVSVTDDLYRNTHTLWLENVPIGEL 91 N TPYKV+V+D+LY H LWL+N PIGEL Sbjct 488 LNPTPYKVAVSDNLYNFIHELWLQNAPIGEL 518 Lambda K H 0.321 0.135 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22844715270 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40