bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1653_orf1 Length=68 Score E Sequences producing significant alignments: (Bits) Value 195103.CPF_0904 77.0 1e-13 > 195103.CPF_0904 Length=158 Score = 77.0 bits (188), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 36/68 (52%), Positives = 46/68 (67%), Gaps = 1/68 (1%) Query 1 MDFYSLKAKTAKGEEICMQAYKGKVLLISNTATKCGFTKQHLKEFHEIKEKYGDQGFEIL 60 M+ Y + K GE + ++ Y+GKVLLI NTA+KCGFTKQ E+ EKY D+GFE+L Sbjct 1 MEIYDISVKDINGENVSLERYRGKVLLIVNTASKCGFTKQ-FDGLEELYEKYKDEGFEVL 59 Query 61 AFPTLQFK 68 FP QFK Sbjct 60 GFPCNQFK 67 Lambda K H 0.321 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22851432268 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40