bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1625_orf2 Length=134 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd5_2900 102 3e-21 > 5807.cgd5_2900 Length=428 Score = 102 bits (255), Expect = 3e-21, Method: Composition-based stats. Identities = 42/90 (46%), Positives = 63/90 (70%), Gaps = 0/90 (0%) Query 15 DSRGRVSNPEEYGGYQVVYRTVSQQHFFNCPFQFARMPDTDCSGEAILRRTAQTADVGSV 74 D R R+ + GGY + R+ QQHFFNCP Q MPD +CS + IL+R A + V Sbjct 202 DPRRRLPSNISVGGYDITARSEVQQHFFNCPHQLTIMPDINCSNDEILKRAANVSQSFRV 261 Query 75 VVHPGDIVVLGTDGLFDNLFDDDVLELVNK 104 V+PGD++++GTDG+FDN+FD+D++++VN+ Sbjct 262 DVNPGDLIIIGTDGIFDNIFDEDIIDIVNQ 291 Lambda K H 0.321 0.137 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22682284714 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40