bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1598_orf1 Length=125 Score E Sequences producing significant alignments: (Bits) Value 382253.COXBU7E912_2125 155 4e-37 > 382253.COXBU7E912_2125 Length=316 Score = 155 bits (391), Expect = 4e-37, Method: Compositional matrix adjust. Identities = 74/124 (59%), Positives = 92/124 (74%), Gaps = 2/124 (1%) Query 2 TPLVRLSRVAAALGISCQLLGKCEFLSPGGSTKDRIARGMIRAAEASGHLAPGCALIEPT 61 TP+VRL R+ +L C+L GKCEFL+PGGS KDRI MI +AE G + PG LIEPT Sbjct 13 TPVVRLHRIGQSL--PCELYGKCEFLNPGGSVKDRIGAAMIESAEKQGKIKPGDTLIEPT 70 Query 62 SGNTGIGLAMASAVIGYRSVAVMPMKMSTEKHRIMKALGSTILRTPTAAAWDEQTSHIAL 121 SGNTGIG+A+A AV GYR + MP KMS EK +++ALG+TI RTPT AA+D+ SHI+L Sbjct 71 SGNTGIGIALAGAVKGYRVIITMPEKMSHEKQVVLEALGATIYRTPTEAAYDDPESHISL 130 Query 122 SLRL 125 + RL Sbjct 131 AKRL 134 Lambda K H 0.320 0.131 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22670743557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40