bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1589_orf2 Length=86 Score E Sequences producing significant alignments: (Bits) Value 7227.CG4817-PA 84.7 7e-16 > 7227.CG4817-PA Length=723 Score = 84.7 bits (208), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 40/70 (57%), Positives = 50/70 (71%), Gaps = 0/70 (0%) Query 2 RPQTAYFLFMNEYREEMKKKNPGYSVTEFAKKAGETWKEMKDKSKWEELAAKAKKNYEKE 61 R TA+ L++N+ RE +K++NPG VTE AKK GE WKE+KDKSKWE+ AAK K+ Y E Sbjct 557 RATTAFMLWLNDTRESIKRENPGIKVTEIAKKGGEMWKELKDKSKWEDAAAKDKQRYHDE 616 Query 62 MVEYKASGGG 71 M YK GG Sbjct 617 MRNYKPEAGG 626 Lambda K H 0.301 0.119 0.329 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22443299781 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40