bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_1561_orf1 Length=143 Score E Sequences producing significant alignments: (Bits) Value 9685.ENSFCAP00000000048 119 4e-26 > 9685.ENSFCAP00000000048 Length=2403 Score = 119 bits (297), Expect = 4e-26, Method: Composition-based stats. Identities = 64/143 (44%), Positives = 98/143 (68%), Gaps = 1/143 (0%) Query 1 AYAKALHYKEKEFLEGQTTDVLGALITINKKLGQEQAAYGVLQYSLKNRISDVEVREKWF 60 AYAKALHYKE EF +G T +L +LI+IN KL Q +AA GVL+Y++K+ ++E++ W+ Sbjct 1245 AYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKH-FGELEIQATWY 1303 Query 61 EKMGNWELAYLSYKFKHEYKSDDIEAILGQSRCLDHLGEYERLSTLVDETFAQQDEQGQS 120 EK+ WE A ++Y K + DD E +LG+ RCL+ LGE+ +L E + +++ Q+ Sbjct 1304 EKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQA 1363 Query 121 RMARLAVQASWSLNKWDKMEEFS 143 +MAR+A A+W L +WD MEE++ Sbjct 1364 KMARMAAAAAWGLGQWDSMEEYT 1386 Lambda K H 0.315 0.130 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40